.
The Open Protein Structure Annotation Network
PDB Keyword
.

2abq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of fructose-1-phosphate kinase from Bacillus halodurans. To be Published
    Site NYSGXRC
    PDB Id 2abq Target Id NYSGXRC-T2083
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8271,7674086 Molecular Weight 32957.75 Da.
    Residues 306 Isoelectric Point 5.50
    Sequence miytvtlnpsidyivqvenfqqgvvnrserdrkqpggkginvsrvlkrlghetkalgflggftgayvrn alekeeiglsfievegdtrinvkikgkqetelngtaplikkehvqalleqltelekgdvlvlagsvpqa mpqtiyrsmtqiakergafvavdtsgealhevlaakpsfikpnhhelselvskpiasiedaiphvqrli gegiesilvsfagdgalfasaegmfhvnvpsgevrnsvgagdsvvagflaalqegksledavpfavaag satafsdgfctreeverlqqqlqrtikkeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2986
    Matthews' coefficent 2.50 Rfactor 0.2549
    Waters 107 Solvent Content 49.40

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2abq
    1. Crystallographic structure of phosphofructokinase-2 from Escherichia coli in complex with two ATP molecules. Implications for substrate inhibition
    R Cabrera, ALB Ambrosio, RC Garratt, V Guix - Journal of molecular , 2008 - Elsevier
     
    2. Ribokinase family evolution and the role of conserved residues at the active site of the PfkB subfamily representative, Pfk-2 from Escherichia coli
    R Cabrera, J Babul, V Guix - Archives of biochemistry and biophysics, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch