.
The Open Protein Structure Annotation Network
PDB Keyword
.

2afa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of putative NAG isomerase from Salmonella typhimurium. To be Published
    Site NYSGXRC
    PDB Id 2afa Target Id NYSGXRC-T1489
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS8177,6752892 Molecular Weight 48976.67 Da.
    Residues 426 Isoelectric Point 5.77
    Sequence mslkwfntlshnrwleqetdrifnfgknavvptgfgwlgnkgqikeemgthlwitarmlhvysvaasmg rpgaydlvdhgikamngalrdkkyggwyacvndqgvvdaskqgyqhffallgaasavttghpearklld ytieviekyfwseeeqmcleswdeafsqtedyrggnanmhaveaflivydvthdkkwldralriasvii hdvarngdyrvnehfdsqwnpirdynkdnpahrfrayggtpghwiewgrlmlhlhaalearfetppawl ledakglfhatirdawapdgadgfvysvvdwdgkpivrervrwpiveamgtayalytltddsqyeewyq kwwdycikylmdyengswwqeldadnkvttkvwdgkqdiyhllhclviprlplapglapavaaglldin akeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.15 Rfree 0.246
    Matthews' coefficent 2.20 Rfactor 0.207
    Waters 661 Solvent Content 43.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2afa
    1. Nothing about protein structure classification makes sense except in the light of evolution
    RE Valas, S Yang, PE Bourne - Current opinion in structural biology, 2009 - Elsevier
     
    2. Crystal Structure of YihS in Complex with d-Mannose: Structural Annotation of Escherichia coli and Salmonella enterica yihS-encoded Proteins to an
    T Itoh, B Mikami, W Hashimoto, K Murata - Journal of molecular biology, 2008 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch