.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ajt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Escherichia coli L-Arabinose Isomerase (ECAI), The Putative Target of Biological Tagatose Production. J.Mol.Biol. 360 297-309 2006
    Site NYSGXRC
    PDB Id 2ajt Target Id NYSGXRC-6358a
    Related PDB Ids 2hxg 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS9402,PF02610, NP_414604.1 Molecular Weight 56041.10 Da.
    Residues 500 Isoelectric Point 5.88
    Sequence mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdeitaicrdany ddpcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdfmnlnqtahggrefgfiga rmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcrfgdnmrevavtdgdkvaaqikfgfsvn twavgdlvqvvnsisdgdvnalvdeyescytmtpatqihgekrqnvleaarielgmkrfleqggfhaft ttfedlhglkqlpglavqrlmqqgygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndl vlgshmlevcpsiaveekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvk tphslpklpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndtrlp afkdalrwnevyygfrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.60 Rfree 0.27796
    Matthews' coefficent 2.50 Rfactor 0.21726
    Waters 88 Solvent Content 50.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ajt
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Crystal Structure of Escherichia coli L-Arabinose Isomerase (ECAI), The Putative Target of Biological Tagatose Production
    BA Manjasetty, MR Chance - Journal of molecular Biology, 2006 - Elsevier
     
    3. Cradle-loop barrels and the concept of metafolds in protein classification by natural descent
    V Alva, KK Koretke, M Coles, AN Lupas - Current opinion in structural , 2008 - Elsevier
     
    4. A high-throughput approach to protein structure analysis
    BA Manjasetty, W Shi, C Zhan, A Fiser, MR Chance - Genetic Engineering, 2007 - Springer
     
    5. Characterization of an L-arabinose isomerase from Bacillus subtilis
    JH Kim, P Prabhu, M Jeya, MK Tiwari, HJ Moon - Applied microbiology , 2010 - Springer
     
    6. The impact of Structural Proteomics on Biotechnology
    BA Manjasetty, AP Turnbull - and Genetic Engineering , 2010 - ingentaconnect.com
     
    7. Current methods in structural proteomics and its applications in biological sciences
    BA Manjasetty, K Bssow, S Panjikar, AP Turnbull - 3 Biotech, 2011 - Springer
     
    8. Creation of Metal-Independent Hyperthermophilic L-Arabinose Isomerase by Homologous Recombination
    YH Hong, DW Lee, YR Pyun - Journal of agricultural and , 2011 - ACS Publications
     
    9. Protein secondary structure predict based on the path with the maximum weight
    L Luo, Z Shao - Computing and Intelligent Systems, 2009. ICIS , 2009 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch