.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ako

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Glutamate 5-kinase from Campylobacter jejuni. To be Published
    Site NYSGXRC
    PDB Id 2ako Target Id NYSGXRC-T2055
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168
    Alias Ids TPS8266,15791485 Molecular Weight 27841.72 Da.
    Residues 251 Isoelectric Point 6.40
    Sequence mkrivvkvgshviseentlsferlknlvaflaklmekyevilvtsaaisaghtkldidrknlinkqvla aigqpflisvynellakfnklggqilltgkdfdsrkatkhaknaidmminlgilpiinendataieeiv fgdndslsayathffdadllvilsdidgfydknpsefsdakrlekithikeewlqatiktgsehgtggi vtklkaakfllehnkkmflasgfdlsvaktflledkqiggtlfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.2213
    Matthews' coefficent 2.59 Rfactor 0.17777
    Waters 712 Solvent Content 52.10

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2ako
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Proline as a stress protectant in yeast: physiological functions, metabolic regulations, and biotechnological applications
    H Takagi - Applied microbiology and biotechnology, 2008 - Springer
     
    3. Structural biology of proline catabolism
    JJ Tanner - Amino acids, 2008 - Springer
     
    4. A Novel Two-domain Architecture Within the Amino Acid Kinase Enzyme Family Revealed by the Crystal Structure of Escherichia coli Glutamate 5-kinase
    C Marco-Marn, F Gil-Ortiz, I Prez-Arellano - Journal of molecular , 2007 - Elsevier
     
    5. Desensitization of feedback inhibition of the Saccharomyces cerevisiae _-glutamyl kinase enhances proline accumulation and freezing tolerance
    T Sekine, A Kawaguchi, Y Hamano - Applied and , 2007 - Am Soc Microbiol
     
    6. Pyrroline_5_carboxylate synthase and proline biosynthesis: From osmotolerance to rare metabolic disease
    I Prez_Arellano, F Carmona_lvarez - Protein , 2010 - Wiley Online Library
     
    7. Molecular mechanisms modulating glutamate kinase activity. Identification of the proline feedback inhibitor binding site
    I Prez-Arellano, F Carmona-lvarez, J Gallego - Journal of molecular , 2010 - Elsevier
     
    8. Understanding pyrroline-5-carboxylate synthetase deficiency: clinical, molecular, functional, and expression studies, structure-based analysis, and novel therapy with
    D Martinelli, J Hberle, V Rubio, C Giunta - Journal of Inherited , 2011 - Springer
     
    9. Glutamate kinase from Thermotoga maritima: characterization of a thermophilic enzyme for proline biosynthesis
    I Prez-Arellano, J Cervera - Extremophiles, 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch