.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ap9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of acetylglutamate kinase from Mycobacterium tuberculosis CDC1551. To be Published
    Site NYSGXRC
    PDB Id 2ap9 Target Id NYSGXRC-T1702
    Molecular Characteristics
    Source Mycobacterium tuberculosis cdc1551
    Alias Ids TPS8221,15841110 Molecular Weight 32170.35 Da.
    Residues 304 Isoelectric Point 5.83
    Sequence mslsriealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihpvvvh gggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpyavgitgedaqlft avrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapdadgvvhninadtaaaavaealg aekllmltdidglytrwpdrdslvseidtgtlaqllptlelgmvpkveaclraviggvpsahiidgrvt hcvlvelftdagtgtkvvrgeghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.80 Rfree 0.284
    Matthews' coefficent 2.73 Rfactor 0.258
    Waters 113 Solvent Content 54.56

    Ligand Information
    Ligands
    Metals NI (NICKEL) x 1;MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2ap9
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Structural Bases of Feed-back Control of Arginine Biosynthesis, Revealed by the Structures of Two Hexameric N-Acetylglutamate Kinases, from
    S Ramn-Maiques, ML Fernndez-Murga - Journal of molecular , 2006 - Elsevier
     
    3. The progress made in determining the Mycobacterium tuberculosis structural proteome
    MT Ehebauer, M Wilmanns - Proteomics, 2011 - Wiley Online Library
     
    4. Site-directed mutagenesis and feedback-resistant N-acetyl-L-glutamate kinase (NAGK) increase Corynebacterium crenatum L-arginine production
    M Xu, Z Rao, W Dou, J Yang, J Jin, Z Xu - Amino acids, 2011 - Springer
     
    5. Using structural information in modeling and multiple alignments for phylogenetics
    MAS Xueliang Pan - 2008 - etd.ohiolink.edu
     
    6. Site-Directed Mutagenesis Studies on the l-Arginine-Binding Sites of Feedback Inhibition in N-Acetyl-l-glutamate Kinase (NAGK) from Corynebacterium glutamicum
    M Xu, Z Rao, W Dou, J Jin, Z Xu - Current microbiology, 2012 - Springer
     
    7. Concentration of Specific Amino Acids at the Catalytic/Active Centers of Highly-Conserved Housekeeping Enzymes of Central Metabolism in Archaea, Bacteria and
    JD Pollack, X Pan, DK Pearl - Origins of Life and Evolution of Biospheres, 2010 - Springer
     
    8. Structural genomics as an approach towards understanding the biology of tuberculosis
    EN Baker - Journal of structural and functional genomics, 2007 - Springer
     
    9. Estate Tax Consequences of Revenue Ruling 2004-64: Silence in Grantor Trusts Is Anything but Golden
    BM Beaman - Drake L. Rev., 2005 - HeinOnline
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch