.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ar0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Type I restriction enzyme EcoKI M protein (EC 2.1.1.72) (M.EcoKI). To be Published
    Site NYSGXRC
    PDB Id 2ar0 Target Id NYSGXRC-T824
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8142,41753 Molecular Weight 60656.75 Da.
    Residues 541 Isoelectric Point 5.23
    Sequence mslnnndlvaklwklcdnlrdggvsyqnyvnelasllflkmcketgqeaeylpegyrwddlksrigqeq lqfyrkmlvhlgeddkklvqavfhnvsttitepkqitalvsnmdsldwyngahgksrddfgdmyegllq knanetksgagqyftprpliktiihllkpqprevvqdpaagtagflieadryvksqtndlddldgdtqd fqihrafiglelvpgtrrlalmncllhdiegnldhggairlgntlgsdgenlpkahivatnppfgsaag tnitrtfvhptsnkqlcfmqhiietlhpggraavvvpdnvlfeggkgtdirrdlmdkchlhtilrlptg ifyaqgvktnvlfftkgtvanpnqdknctddvwvydlrtnmpsfgkrtpftdehlqpfervygedphgl sprtegewsfnaeetevadseenkntdqhlatsrwrkfsrewirtaksdsldiswlkdkdsidadslpe pdvlaaeamgelvqalseldalmrelgasdeadlqrqlleeafggvkeeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.261
    Matthews' coefficent 3.17 Rfactor 0.224
    Waters 143 Solvent Content 60.86

    Ligand Information
    Ligands UNX (UNKNOWN) x 10
    Metals

    Jmol

     
    Google Scholar output for 2ar0
    1. The structure of M. EcoKI Type I DNA methyltransferase with a DNA mimic antirestriction protein
    CK Kennaway, A Obarska-Kosinska - Nucleic acids , 2009 - Oxford Univ Press
     
    2. De-orphaning the structural proteome through reciprocal comparison of evolutionarily important structural features
    RM Ward, S Erdin, TA Tran, DM Kristensen - PloS one, 2008 - dx.plos.org
     
    3. Structural model for the multisubunit Type IC restrictionmodification DNA methyltransferase M. EcoR124I in complex with DNA
    A Obarska, A Blundell, M Feder - Nucleic acids , 2006 - Oxford Univ Press
     
    4. Shape and subunit organisation of the DNA methyltransferase M. AhdI by small-angle neutron scattering
    P Callow, A Sukhodub, JE Taylor, GG Kneale - Journal of molecular biology, 2007 - Elsevier
     
    5. Functional analysis of MmeI from methanol utilizer Methylophilus methylotrophus, a subtype IIC restriction-modification enzyme related to type I enzymes
    J Nakonieczna, T Kaczorowski - Applied and , 2009 - Am Soc Microbiol
     
    6. The fragment structure of a putative HsdR subunit of a type I restriction enzyme from Vibrio vulnificus YJ016: implications for DNA restriction and translocation activity
    NT Uyen, SY Park, JW Choi, HJ Lee - Nucleic acids , 2009 - Oxford Univ Press
     
    7. Structural and Functional Analysis of the Engineered Type I DNA Methyltransferase EcoR124I NT
    JE Taylor, P Callow, A Swiderska, GG Kneale - Journal of molecular biology, 2010 - Elsevier
     
    8. Structure and operation of the DNA-translocating type I DNA restriction enzymes
    CK Kennaway, JE Taylor, CF Song - Genes & , 2012 - genesdev.cshlp.org
     
    9. Crystallization and preliminary X-ray diffraction analysis of the HsdR subunit of a putative type I restriction enzyme from Vibrio vulnificus YJ016
    NT Uyen, K Nishi, SY Park, JW Choi - Section F: Structural , 2008 - scripts.iucr.org
     
    10. Expression, crystallization and preliminary X-ray diffraction analysis of a modification subunit of a putative type I restriction enzyme from Vibrio vulnificus YJ016
    HJ Lee, K Nishi, JM Song, JS Kim - Acta Crystallographica Section F: , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch