.
The Open Protein Structure Annotation Network
PDB Keyword
.

2awd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of LacC from Enterococcus faecalis. To be Published
    Site NYSGXRC
    PDB Id 2awd Target Id NYSGXRC-T2082
    Related PDB Ids 2f02 
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS8269,29376350 Molecular Weight 33782.93 Da.
    Residues 313 Isoelectric Point 5.50
    Sequence vivtvtmnpsidisylldhlkldtvnrtsqvtktpggkglnvtrvihdlggdviatgvlggfhgafian elkkanipqaftsikeetrdsiailhegnqteileagptvspeeisnflenfdqlikqaeivtisgsla kglpsdfyqelvqkahaqevkvlldtsgdslrqvlqgpwkpylikpnleelegllgqdfsenplaavqt altkpmfagiewivislgkdgaiakhhdqfyrvkiptiqaknpvgsgdatiaglayglakdapaaellk wgmaagmanaqermtghvdvenvkkhlmniqvveiak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24617
    Matthews' coefficent 2.56 Rfactor 0.19342
    Waters 359 Solvent Content 51.50

    Ligand Information
    Ligands
    Metals BR (BROMIDE) x 12

    Jmol

     
    Google Scholar output for 2awd
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Structure of Methanocaldococcus jannaschii nucleoside kinase: an archaeal member of the ribokinase family
    L Arnfors, T Hansen, P Schonheit - Section D: Biological , 2006 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch