The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Proc.Natl.Acad.Sci.Usa 103 2063-2068 2006
    Site NYSGXRC
    PDB Id 2b4d Target Id NYSGXRC-9502a
    Related PDB Ids 2b3u 2b58 2b5g 2b3v 2b4b 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7850,NP_00296, PF00583 Molecular Weight 20022.95 Da.
    Residues 171 Isoelectric Point 5.09
    Sequence makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpkehwtpegh sivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcssmhflvaewnepsin fykrrgasdlsseegwrlfkidkeyllkmatee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree
    Matthews' coefficent 2.15 Rfactor 0.221
    Waters 75 Solvent Content 42.79

    Ligand Information
    Ligands COA (COENZYME) x 2


    Google Scholar output for 2b4d
    1. Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
    MC Bewley, V Graziano, J Jiang - Proceedings of the , 2006 - National Acad Sciences
    2. The Crystal Structure of Spermidine/Spermine N 1-Acetyltransferase in Complex with Spermine Provides Insights into Substrate Binding and Catalysis,
    EJ Montemayor, DW Hoffman - Biochemistry, 2008 - ACS Publications

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch