.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b5g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Proc.Natl.Acad.Sci.Usa 103 2063-2068 2006
    Site NYSGXRC
    PDB Id 2b5g Target Id NYSGXRC-9502a
    Related PDB Ids 2b3u 2b58 2b4d 2b3v 2b4b 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7849,NP_00296, PF00583 Molecular Weight 20022.95 Da.
    Residues 171 Isoelectric Point 5.09
    Sequence makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpkehwtpegh sivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcssmhflvaewnepsin fykrrgasdlsseegwrlfkidkeyllkmatee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.241
    Matthews' coefficent 2.13 Rfactor 0.211
    Waters 323 Solvent Content 42.27

    Ligand Information
    Ligands SO4 (SULFATE) x 7
    Metals

    Jmol

     
    Google Scholar output for 2b5g
    1. Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
    MC Bewley, V Graziano, J Jiang - Proceedings of the , 2006 - National Acad Sciences
     
    2. Conformational changes in redox pairs of protein structures
    SW Fan, RA George, NL Haworth, LL Feng - Protein , 2009 - Wiley Online Library
     
    3. Crystal structure of Homo sapiens thialysine N__acetyltransferase (HsSSAT2) in complex with acetyl coenzyme A
    BW Han, CA Bingman, GE Wesenberg - Proteins: Structure, , 2006 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch