.
The Open Protein Structure Annotation Network
PDB Keyword
.

2esr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of hypothetical protein of Streptococcus Pygenes. To be Published
    Site NYSGXRC
    PDB Id 2esr Target Id NYSGXRC-6074g
    Molecular Characteristics
    Source Streptococcus pyogenes
    Alias Ids TPS7749,NP_269611.1, PF03602 Molecular Weight 19565.90 Da.
    Residues 179 Isoelectric Point 9.08
    Sequence mrvvsgefggrplktldgkitrptsdkvrgaifnmigpyfnggrvldlfagsgglaieavsrgmsaavl veknrkaqaiiqdniimtkaenrftllkmeaeraidcltgrfdlvfldppyaketivatiealaaknll seqvmvvcetdktvllpkeiatlgiwkekiygiskvtvyvn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.249
    Matthews' coefficent 2.43 Rfactor 0.216
    Waters 205 Solvent Content 49.32

    Ligand Information
    Ligands GLC (ALPHA-D-GLUCOSE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2esr
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Structural and Functional Characterization of Rv2966c Protein Reveals an RsmD-like Methyltransferase from Mycobacterium tuberculosis and the Role of Its N-
    A Kumar, K Saigal, K Malhotra, KM Sinha - Journal of Biological , 2011 - ASBMB
     
    3. Structural and functional characterization of Rv2966c reveals an RsmD-like methyltransferase from M. tuberculosis and the role of its N-terminal domain in target
    A Kumar, K Saigal, K Malhotra, KM Sinha - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch