The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a probable acetyltransferase. To be Published
    Site NYSGXRC
    PDB Id 2eui Target Id NYSGXRC-T1065
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS8154,Q9HX01 Molecular Weight 18047.76 Da.
    Residues 153 Isoelectric Point 6.44
    Sequence mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladeedrllgfcqlyps fsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvstsvdnevaqkvyesigfred qefknytlpisdels
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.283
    Matthews' coefficent 3.03 Rfactor 0.227
    Waters 137 Solvent Content 59.41

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch