.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f02

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of LacC from Enterococcus Faecalis in complex with ATP. To be Published
    Site NYSGXRC
    PDB Id 2f02 Target Id NYSGXRC-T2082
    Related PDB Ids 2awd 
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS8270,29376350 Molecular Weight 33782.93 Da.
    Residues 313 Isoelectric Point 5.50
    Sequence vivtvtmnpsidisylldhlkldtvnrtsqvtktpggkglnvtrvihdlggdviatgvlggfhgafian elkkanipqaftsikeetrdsiailhegnqteileagptvspeeisnflenfdqlikqaeivtisgsla kglpsdfyqelvqkahaqevkvlldtsgdslrqvlqgpwkpylikpnleelegllgqdfsenplaavqt altkpmfagiewivislgkdgaiakhhdqfyrvkiptiqaknpvgsgdatiaglayglakdapaaellk wgmaagmanaqermtghvdvenvkkhlmniqvveiak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.23996
    Matthews' coefficent 2.67 Rfactor 0.20111
    Waters 409 Solvent Content 53.92

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch