.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f1r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of molybdopterin-guanine dinucleotide biosynthesis protein B (mobB). To be Published
    Site NYSGXRC
    PDB Id 2f1r Target Id NYSGXRC-T1540
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS8192,11499834 Molecular Weight 19699.47 Da.
    Residues 171 Isoelectric Point 6.55
    Sequence mslilsivgtsdsgkttlitrmmpilrerglrvavvkrhahgdfeidkegkdswkiynsgadvviaspv klafirrvseeegndldwiyerylsdydlvitegfskagkdrivvvkkpeevehfrqgrilavvcderv dghkwfrrdeveriaefilsllreggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2534
    Matthews' coefficent 2.02 Rfactor 0.1861
    Waters 166 Solvent Content 39.14

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1;PR (PRASEODYMIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch