.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f4n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved protein of unknown function (MJ1651) from Methanococcus jannaschii. Proteins 70 572-577 2008
    Site NYSGXRC
    PDB Id 2f4n Target Id NYSGXRC-T1640
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8210,15669847 Molecular Weight 31324.47 Da.
    Residues 273 Isoelectric Point 6.31
    Sequence mslgiymrddildiitlttdfgtnegyvgamkgrilnilkkynkdakiidisheikpfniyhgayvllt aipyfppsvhvavidptvgserksivietksgyylvgpdnglftyvaeklgikriikideerykpsstf hgrdvyavvgaeilinngydgeeldemvkidetkkrvihidrfgniitnikkdevtfkyydtimikirh kngiekiikckfvksyfeeknnficlinsegfleiskfmdnaskllnvdyldeieieggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.50 Rfree 0.265
    Matthews' coefficent 2.52 Rfactor 0.237
    Waters 31 Solvent Content 51.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2f4n
    1. The fluorinase, the chlorinase and the duf-62 enzymes
    H Deng, D O'Hagan - Current opinion in chemical biology, 2008 - Elsevier
     
    2. S_Adenosyl_L_methionine: Hydroxide Adenosyltransferase: A SAM Enzyme
    H Deng, CH Botting, JTG Hamilton - Angewandte , 2008 - Wiley Online Library
     
    3. S_Adenosyl_L_Methionine Hydrolase (Adenosine_Forming), a Conserved Bacterial and Archeal Protein Related to SAM_Dependent Halogenases
    AS Eustquio, J Hrle, JP Noel, BS Moore - ChemBioChem, 2008 - Wiley Online Library
     
    4. Crystal structure of a conserved protein of unknown function (MJ1651) from Methanococcus jannaschii
    KN Rao, SK Burley - : Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch