.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f7f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Enterococcus Faecalis Nicotinate Phosphoribosyltransferase. To be Published
    Site NYSGXRC
    PDB Id 2f7f Target Id NYSGXRC-6261b
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS9401,NP_816265.1 Molecular Weight 56579.16 Da.
    Residues 494 Isoelectric Point 5.03
    Sequence mdytyaddsltlhtdmyqinmmqtywelgradlhavfecyfrempfnhgyaifaglerlvnylenltft esdiaylreveeypedfltylanfefkctvrsalegdlvfnnepliqiegplaqcqlvetallnmvnfq tliatkaariksvigddpllefgtrraqeldaaiwgtraayiggadatsnvragkifgipvsgthahsl vqsygndyeafmayakthrdcvflvdtydtlkagvpsairvaremgdkinflgvridsgdmayiskrvr eqldeagfteakiyasndldentilnlkmqkskidvwgvgtklitaydqpalgavfklvsiegedgqmk dtiklssnaekvttpgkkqvwritrksdkksegdyvtlwnedprqeeeiymfhpvhtfinkyvrdfear pvlqdifvegkrvyelptldeikqyakenldslweeykrdlnpqkypvdlstdcwnhkmnllekvrkdv khltetvnkea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.21362
    Matthews' coefficent 2.47 Rfactor 0.17066
    Waters 390 Solvent Content 49.73

    Ligand Information
    Ligands SO4 (SULFATE) x 8;NIO (NICOTINIC) x 2;DPO (DIPHOSPHATE) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2f7f
    1. The GD box: A widespread noncontiguous supersecondary structural element
    V Alva, S Dunin_Horkawicz, M Habeck - Protein , 2009 - Wiley Online Library
     
    2. Characterization of human nicotinate phosphoribosyltransferase: Kinetic studies, structure prediction and functional analysis by site-directed mutagenesis
    L Galassi, M Di Stefano, L Brunetti, G Orsomando - Biochimie, 2011 - Elsevier
     
    3. Structure-based functional inference of hypothetical proteins from Mycoplasma hyopneumoniae
    MM Da Fonsca, A Zaha, ER Caffarena - Journal of Molecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch