.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fgs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Campylobacter Jejuni YceI Periplasmic Protein. To be Published
    Site NYSGXRC
    PDB Id 2fgs Target Id NYSGXRC-T1576
    Molecular Characteristics
    Source Campylobacter jejuni
    Alias Ids TPS8195,15791787 Molecular Weight 22390.31 Da.
    Residues 202 Isoelectric Point 8.53
    Sequence mslkkvllsslvavsllstglfakeytldkahtdvgfkikhlqisnvkgnfkdysavidfdpasaefkk ldvtikiasvntenqtrdnhlqqddffkakkypdmtftmkkyekidnekgkmtgtltiagvskdivlda eiggvakgkdgkekigfslngkikrsdfkfatststitlsddinlnieveanekeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.90 Rfree 0.27986
    Matthews' coefficent 6.10 Rfactor 0.24314
    Waters Solvent Content 78.25

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2fgs
    1. Structure of a polyisoprenoid binding domain from Saccharophagus degradans implicated in plant cell wall breakdown
    F Vincent, DD Molin, RM Weiner, Y Bourne - FEBS letters, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch