.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fh7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.STRUCT.FUNCT.GENOM. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2fh7 Target Id NYSGXRC-8623a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7908,PF00102, NP_002841 Molecular Weight 217083.14 Da.
    Residues 1948 Isoelectric Point 6.09
    Sequence maptwgpgmvsvvgpmgllvvllvggcaaeepprfikepkdqigvsggvasfvcqatgdpkprvtwnkk gkkvnsqrfetiefdesagavlriqplrtprdenvyecvaqnsvgeitvhakltvlredqlpsgfpnid mgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvdpsasngrikqlrsetfestpirgalqiesse etdqgkyecvatnsagvrysspanlyvrelrevrrvaprfsilpmsheimpggnvnitcvavgspmpyv kwmqgaedltpeddmpvgrnvleltdvkdsanytcvamsslgvieavaqitvkslpkapgtpmvtenta tsititwdsgnpdpvsyyvieyksksqdgpyqikeditttrysigglspnseyeiwvsavnsigqgpps esvvtrtgeqapasaprnvqarmlsattmivqweepvepnglirgyrvyytmepehpvgnwqkhnvdds llttvgslledetytvrvlaftsvgdgplsdpiqvktqqgvpgqpmnlraearsetsitlswspprqes iikyellfregdhgrevgrtfdpttsyvvedlkpnteyafrlaarspqglgaftpvvrqrtlqskpsap pqdvkcvsvrstailvswrppppethngalvgysvryrplgsedpepkevngipptttqillealekwt qyrittvahtevgpgpesspvvvrtdedvpsapprkveaealnatairvlwrspapgrqhgqirgyqvh yvrmegaeargpprikdvmladaqwetddtaeyemvitnlqpetaysitvaaytmkgdgarskpkvvvt kgavlgrptlsvqqtpegsllarweppagtaedqvlgyrlqfgredstplatlefppsedrytasgvhk gatyvfrlaarsrgglgeeaaevlsipedtprghpqileaagnasagtvllrwlppvpaerngaivkyt vavreagalgparetelpaaaepgaenaltlqglkpdtaydlqvrahtrrgpgpfsppvryrtflrdqv spknfkvkmimktsvllswefpdnynsptpykiqyngltldvdgrttkklithlkphtfynfvltnrgs slgglqqtvtawtafnllngkpsvapkpdadgfimvylpdgqspvpvqsyfivmvplrksrggqfltpl gspedmdleeliqdisrlqrrslrhsrqlevprpyiaarfsvlpptfhpgdqkqyggfdnrglepghry vlfvlavlqkseptfaaspfsdpfqldnpdpqpivdgeegliwvigpvlavvfiiciviaillyknkpd skrkdseprtkcllnnadlaphhpkdpvemrrinfqtpdsglrsplrepgfhfesmlshppipiadmae hterlkandslklsqeyesidpgqqftwehsnlevnkpknryanviaydhsrvilqpiegimgsdyina nyvdgyrrqnayiatqgplpetfgdfwrmvweqrsativmmtrleeksrikcdqywpnrgtetygfiqv tlldtielatfcvrtfslhkngssekrevrqfqftawpdhgvpeyptpflaflrrvktcnppdagpivv hcsagvgrtgcfividamlerikpektvdvyghvtlmrsqrnymvqtedqysfihealleavgcgntev parslyayiqklaqvepgehvtgmelefkrlanskahtsrfisanlpcnkfknrlvnimpyestrvclq pirgvegsdyinasfidgyrqqkayiatqgplaettedfwrmlwennstivvmltklremgrekchqyw paersaryqyfvvdpmaeynmpqyilrefkvtdardgqsrtvrqfqftdwpeqgvpksgegfidfigqv hktkeqfgqdgpisvhcsagvgrtgvfitlsivlermryegvvdifqtvkmlrtqrpamvqtedeyqfcyqaaleylgsfdhyat
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.238
    Matthews' coefficent 2.30 Rfactor 0.19
    Waters 361 Solvent Content 46.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fh7
    1. Protein tyrosine phosphatases: structurefunction relationships
    L Tabernero, AR Aricescu, EY Jones - FEBS , 2008 - Wiley Online Library
     
    2. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    3. Research Non-homologous isofunctional enzymes: A systematic analysis of alternative solutions in enzyme evolution
    MV Omelchenko, MY Galperin, YI Wolf, EV Koonin - 2010 - biomedcentral.com
     
    4. Structural analysis of a multifunctional, tandemly repeated inositol polyphosphatase
    RJ Gruninger, LB Selinger, SC Mosimann - Journal of molecular biology, 2009 - Elsevier
     
    5. Modulation of Catalytic Activity in Multi-Domain Protein Tyrosine Phosphatases
    LL Madan, S Veeranna, K Shameer, CCS Reddy - PloS one, 2011 - dx.plos.org
     
    6. Structural insights into the homology and differences between mouse protein tyrosine phosphatase-sigma and human protein tyrosine phosphatase-sigma
    L Hou, J Wang, Y Zhou, J Li - Acta biochimica et , 2011 - abbs.oxfordjournals.org
     
    7. Large cryptic internal sequence repeats in protein structures from Homo sapiens
    R Sarani, NA Udayaprakash, R Subashini - Journal of , 2009 - Springer
     
    8. Discovery of Potent Inhibitors of Receptor Protein Tyrosine Phosphatase Sigma through the Structure-Based Virtual Screening
    H Park, PN Chien, SE Ryu - Bioorganic & Medicinal Chemistry Letters, 2012 - Elsevier
     
    9. Structure and mechanism of protein tyrosine phosphatase-like phytases
    RJ Gruninger - 2009 - uleth.ca
     
    10. Methods for Treating Autophagy-Related Disorders
    JP Mackeigan, K Martin, HE Xu - US Patent , 2012 - freepatentsonline.com
     
    11. Avirulence proteins AvrBs7 from Xanthomonas gardneri and AvrBs1. 1 from Xanthomonas euvesicatoria contribute to a novel gene-for-gene interaction in pepper
    N Potnis, GV Minsavage, JK Smith - Molecular Plant- , 2011 - Am Phytopath Society
     

    Protein Summary



    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch