.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g64

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Caenorhabditis Elegans 6-Pyruvoyl Tetrahydropterin Synthase. To be Published
    Site NYSGXRC
    PDB Id 2g64 Target Id NYSGXRC-T2216
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS8281,93279885 Molecular Weight 16029.55 Da.
    Residues 140 Isoelectric Point 7.84
    Sequence mfrmpivtmervdsfsaahrlhseklsdaenketfgkcnnsnghghnyvwkvklrgevdptsgmvydla klkkemslvldtvdhrnldkdveffkttvstsenvaiymfeklksvmsnpsvlykvtieetpkniftyk gs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.21902
    Matthews' coefficent 2.34 Rfactor 0.16058
    Waters 167 Solvent Content 47.38

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals NA (SODIUM) x 2;ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2g64
    1. An atypical orthologue of 6_pyruvoyltetrahydropterin synthase can provide the missing link in the folate biosynthesis pathway of malaria parasites
    S Dittrich, SL Mitchell, AM Blagborough - Molecular , 2008 - Wiley Online Library
     
    2. Plasmodium falciparum: a paradigm for alternative folate biosynthesis in diverse microorganisms?
    JE Hyde, S Dittrich, P Wang, PFG Sims - Trends in , 2008 - Elsevier
     
    3. Structure of a 6-pyruvoyltetrahydropterin synthase homolog from Streptomyces coelicolor
    JE Spoonamore, SA Roberts, A Heroux - Section F: Structural , 2008 - scripts.iucr.org
     
    4. Correspondences between low_energy modes in enzymes: Dynamics_based alignment of enzymatic functional families
    A Zen, V Carnevale, AM Lesk, C Micheletti - Protein Science, 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch