.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g6t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein from Clostridium acetobutylicum. To be Published
    Site NYSGXRC
    PDB Id 2g6t Target Id NYSGXRC-T1230
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS8159,Q97H28 Molecular Weight 36239.75 Da.
    Residues 305 Isoelectric Point 6.38
    Sequence mykcliwgvndeytlaydkllfeiskgnlsiealiskdkyakyidgkevidkteisnyefdyiiifnke rysdiknealelgiperkilngkfffisnfdfkrycklienpitiisddcwgglvssylgfkfnspfin fyihnddyikflenmdyyleqelkveqegnvysctmpkgslgtgdnkiilnfnhqasfaeakndwderk trinkknlfvkmlikddneklvkrfdnlpyknkvcfhpkpmkyksvaffpryiwrcinyaartsnsnle qytmdmswlekscdilkmlcgeedfirek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.257
    Matthews' coefficent 3.84 Rfactor 0.213
    Waters 51 Solvent Content 67.99

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch