.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gdq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of mandelate racemase/muconate lactonizing enzyme from Bacillus subtilis at 1.8 A resolution. To be Published
    Site NYSGXRC
    PDB Id 2gdq Target Id NYSGXRC-9293a
    Related PDB Ids 2gge 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS7810,16078161, PF01188 Molecular Weight 42017.90 Da.
    Residues 371 Isoelectric Point 7.71
    Sequence vkivrietfplfhrlekpygdangfkryrtcyliriitesgidgwgecvdwlpalhvgftkriipfllg kqagsrlslvrtiqkwhqraasavsmalteiaakaadcsvcelwggryreeipvyasfqsysdspqwis rsvsnveaqlkkgfeqikvkiggtsfkedvrhinalqhtagssitmildanqsydaaaafkweryfsew tnigwleeplpfdqpqdyamlrsrlsvpvaggenmkgpaqyvpllsqrcldiiqpdvmhvngidefrdc lqlaryfgvrasahaydgslsrlyalfaqaclppwskmkndhiepiewdvmenpftdlvslqpskgmvh ipkgkgigteinmeivnrykwdgsay
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.252
    Matthews' coefficent 2.32 Rfactor 0.197
    Waters 741 Solvent Content 47.03

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gdq
    1. Revisiting gap locations in amino acid sequence alignments and a proposal for a method to improve them by introducing solvent accessibility
    A Hijikata, K Yura, T Noguti, M Go - : Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch