.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gl5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Dehydratase from Salmonella Thyphimurium Lt2. To be Published
    Site NYSGXRC
    PDB Id 2gl5 Target Id NYSGXRC-9270a
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS7799,16765600, PF01188 Molecular Weight 44444.26 Da.
    Residues 400 Isoelectric Point 5.18
    Sequence mkitsievfdcelkkrdqtmssynpvlirvntdsglsgigevglaygagakagvgiirdlaplivgedp lniekiwefffrktfwgmgggnvfyagmsaidialwdikgkylgvpvyqllggktneklrtyasqlqfg wgdkrhilvtpeeyaeaaraalddgydaikvdpleidrngddcvfqnrnrnysgllladqlkmgearia amreamgddadiiveihsllgtnsaiqfakaiekyriflyeepihplnsdnmqkvsrsttipiatgers ytrwgyrellekqsiavaqpdlclcggitegkkicdyaniydttvqvhvcggpvstvaalhmetaipnf iihehhtnamkasirelcthdyqpengyyvapeqpglgqelndevvkeylayvik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.218
    Matthews' coefficent 2.17 Rfactor 0.185
    Waters 624 Solvent Content 45.00

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2gl5
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch