.
The Open Protein Structure Annotation Network
PDB Keyword
.

2glf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Aminipeptidase (M18 family) from Thermotoga Maritima. To be Published
    Site NYSGXRC
    PDB Id 2glf Target Id NYSGXRC-T1806
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8246,15643133 Molecular Weight 50491.30 Da.
    Residues 452 Isoelectric Point 5.59
    Sequence lmkmerknvwhhrkkeeieafskeymefmskaktermtvkeikrildesgfvpledfagdpmnmtvyav nrgkaiaafrvvddlkrglnlvvahidsprldfkpnpliedeqialfkthyyggikkyhwlsipleihg vlfkndgteieihigdkpedpvftipdllphldkedakisekfkgenlmliagtiplsgeekeavktnv lkilnemygiteedfvsgeievvpafsprevgmdrsligaygqddricaytalrallsanpeksigvif fdkeeigsdgntgakarfylkalrqilkmqgakdsefvldevlentsvisgdvcaavnppykdvhdlhn apklgygvalvkytgargkystndahaefvarvrkvlneqgviwqvatlgkvdqggggtiakffaergs dvidmgpallgmhspfeisskadlfetyvayrslmekl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.239
    Matthews' coefficent 2.86 Rfactor 0.168
    Waters 479 Solvent Content 56.98

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 8

    Jmol

     
    Google Scholar output for 2glf
    1. Cloning, expression, crystallization and preliminary X-ray crystallographic analysis of aspartyl aminopeptidase from the apeB gene of Pseudomonas aeruginosa
    S Natarajan, R Mathews - Acta Crystallographica Section F: , 2012 - scripts.iucr.org
     
    2. X-ray crystal structure and specificity of the Plasmodium falciparum malaria aminopeptidase Pf M18AAP
    KK Sivaraman, CA Oellig, K Huynh, SC Atkinson - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch