.
The Open Protein Structure Annotation Network
PDB Keyword
.

2glj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title crystal structure of aminopeptidase I from Clostridium acetobutylicum. To be Published
    Site NYSGXRC
    PDB Id 2glj Target Id NYSGXRC-T1817
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS8249,15894376 Molecular Weight 52008.51 Da.
    Residues 465 Isoelectric Point 5.11
    Sequence mpndllkeyknawdkyddkqlkevfalgdrfknfisnckterecvteliktaeksgyrniedilakget lkegdkvyannrgkglimfligkeplytgfkilgahidsprldlkqnplyedtdlamlethyyggikky qwvtlplaihgvivkkdgtivnvcvgeddndpvfgvsdilvhlaseqlekkaskviegedlniligsip lkdgeekqkvkhnimkilnekydiseedfvsaeleivpagkardygfdrsmvmgygqddricaytsfea mlemknakktcitilvdkeevgsigatgmqskffentvadimslcgdydelklrkalynsemlssdvsa afdpnypnvmekrnsaylgkgivfnkytgsrgksgcndanpeyiaelrrilskesvnwqtaelgkvdqg gggtiayilaeygmqvidcgvallnmhapweisskadiyetkngysaflnn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 24
    Resolution (Å) 3.20 Rfree 0.297
    Matthews' coefficent 2.53 Rfactor 0.25
    Waters 5233 Solvent Content 51.43

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 48

    Jmol

     
    Google Scholar output for 2glj
    1. Cloning, expression, crystallization and preliminary X-ray crystallographic analysis of aspartyl aminopeptidase from the apeB gene of Pseudomonas aeruginosa
    S Natarajan, R Mathews - Acta Crystallographica Section F: , 2012 - scripts.iucr.org
     
    2. X-ray crystal structure and specificity of the Plasmodium falciparum malaria aminopeptidase Pf M18AAP
    KK Sivaraman, CA Oellig, K Huynh, SC Atkinson - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch