.
The Open Protein Structure Annotation Network
PDB Keyword
.

2glu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of YcgJ protein from Bacillus subitilis. To be Published
    Site NYSGXRC
    PDB Id 2glu Target Id NYSGXRC-T1761
    Related PDB Ids 1xxl 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8231,16077385 Molecular Weight 26962.97 Da.
    Residues 238 Isoelectric Point 6.08
    Sequence mslglmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevassfaqekgvenvrfqqg taeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrfllvdhyapedpvldefvnhlnrlrd pshvresslsewqamfsanqlayqdiqkwnlpiqydswikrggtpadrekqiithlnhasdeardtfci tlnqngqpisfclkailiqgikreghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.91 Rfree 0.28257
    Matthews' coefficent 2.90 Rfactor 0.19234
    Waters 92 Solvent Content 57.57

    Ligand Information
    Ligands SO4 (SULFATE) x 11;SAM (S-ADENOSYLMETHIONINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2glu
    1. Identification of a Missing Sequence and Functionally Important Residues of 16S rRNA: m^ 1A1408 Methyltransferase KamB that Causes Bacterial Resistance to
    L Koscinski, M Feder - CELL CYCLE-LANDES , 2007 - landesbioscience.com
     
    2. The Elongator subcomplex Elp456 is a hexameric RecA-like ATPase
    S Glatt, J Ltoquart, C Faux, NMI Taylor - Nature Structural & , 2012 - nature.com
     
    3. STREPTAVIDIN MACROMOLECULAR ADAPTOR AND COMPLEXES THEREOF
    FR Salemme, PC Weber - US Patent App. 12/766,658, 2010 - Google Patents
     
    4. Metal Ion-Mediated DNA-Protein Interactions
    B Zambelli, F Musiani, S Ciurli - Interplay between Metal Ions and Nucleic , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch