.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gok

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of imidazolonepropionase from Agrobacterium tumefaciens at 1.87 A resolution. Proteins 69 652-658 2007
    Site NYSGXRC
    PDB Id 2gok Target Id NYSGXRC-9252b
    Related PDB Ids 2puz 
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS7782,17937637, PF01979 Molecular Weight 44396.88 Da.
    Residues 419 Isoelectric Point 5.12
    Sequence mpgnnsakgtatgnatalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadett dcggrwitpalidchthlvfggnramefemrlngatyeeiakagggivssvrdtralsdevlvaqalpr ldtllsegvstieiksgygldietelkmlrvarrletlrpvrivtsylaahatpadykgrnadyitdvv lpglekahaegladavdgfcegiafsvkeidrvfaaaqqrglpvklhaeqlsnlggaelaasynalsad hleyldetgakalakagtvavllpgafyalrekqlppvqalrdagaeialatdcnpgtspltsllltmn mgatlfrmtveecltattrnaakalgllaetgtleagksadfaiwdierpaelvyrigfnplharifkgqkvsp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.87 Rfree 0.231
    Matthews' coefficent 2.36 Rfactor 0.207
    Waters 496 Solvent Content 47.84

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals MG (MAGNESIUM) x 2;FE (FE) x 2;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2gok
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    3. Characterization of the phenylurea hydrolases A and B: founding members of a novel amidohydrolase subgroup
    J Khurana, C Jackson, C Scott, G Pandey, I Horne - Biochem. J, 2009 - biochemj.org
     
    4. Catalytic improvement and evolution of atrazine chlorohydrolase
    C Scott, CJ Jackson, CW Coppin - Applied and , 2009 - Am Soc Microbiol
     
    5. A Common Catalytic Mechanism for Proteins of the HutI Family
    R Tyagi, S Eswaramoorthy, SK Burley, FM Raushel - Biochemistry, 2008 - ACS Publications
     
    6. Crystal structure of monofunctional histidinol phosphate phosphatase from Thermus thermophilus HB8
    R Omi, M Goto, I Miyahara, M Manzoku, A Ebihara - Biochemistry, 2007 - ACS Publications
     
    7. X_ray structure of imidazolonepropionase from Agrobacterium tumefaciens at 1.87 resolution
    R Tyagi, D Kumaran, SK Burley - Proteins: Structure, , 2007 - Wiley Online Library
     
    8. ENZYMES AND METHODS FOR HYDROLYSING PHENYLUREAS, CARBAMATES AND ORGANOPHOSPHATES
    JL Khurana, CJ Jackson, C Scott - US Patent , 2011 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch