.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gpy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative O-methyltransferase from Bacillus halodurans. To be Published
    Site NYSGXRC
    PDB Id 2gpy Target Id NYSGXRC-T1759
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS8229,15613835 Molecular Weight 26939.46 Da.
    Residues 233 Isoelectric Point 5.77
    Sequence mslieerlkhylekqipardqyieqmereaheqqvpimdllgmesllhllkmaaparileigtaigysa irmaqalpeativsierderryeeahkhvkalglesriellfgdalqlgeklelyplfdvlfidaakgq yrrffdmyspmvrpgglilsdnvlfrglvaetdiehkrhkqlatkidtynqwllehpqydtrifpvgdg iaisikretkgdtddekaeghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.248
    Matthews' coefficent 2.00 Rfactor 0.206
    Waters 179 Solvent Content 38.44

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 9;MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch