.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gsh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of L-rhamnonate dehydratase from Salmonella Typhimurium Lt2. To be Published
    Site NYSGXRC
    PDB Id 2gsh Target Id NYSGXRC-9265a
    Related PDB Ids 3d46 2p3z 3box 3d47 
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS7794,16765618, PF01188 Molecular Weight 44703.86 Da.
    Residues 405 Isoelectric Point 5.92
    Sequence menimtlpkikhvrawfiggataekgagggdyhdqggnhwiddhiatpmskyrdyeqsrqsfginvlgt liveveaenrqtgfavstagemgcfivekhlnrfiegkcvsdiklihdqmlgatmyysgsgglvmntis cvdlalwdlfgkvvglpvykllggavrdeiqfyatgarpdlakemgfiggkmpthwgphdgdagirkda amvadmrekcgpdfwlmldcwmsqdvnyatklahacapfnlkwieeclppqqyegyrelkrnapagmmv tsgehhgtlqsfrtlaetgidimqpdvgwcgglttlveiaalaksrgqlvvphgssvyshhavitftnt pfseflmtspdcstlrpqfdpilldepvpvngrihksvldkpgfgvelnrdchlkrpysh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.39 Rfree 0.24084
    Matthews' coefficent 2.20 Rfactor 0.19403
    Waters 205 Solvent Content 44.70

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2gsh
    1. Why is 11_-hydroxysteroid dehydrogenase type 1 facing the endoplasmic reticulum lumen?: Physiological relevance of the membrane topology of 11_-HSD1
    A Odermatt, AG Atanasov, Z Balazs - Molecular and cellular , 2006 - Elsevier
     
    2. Fluorescent protein-based redox probes
    AJ Meyer, TP Dick - Antioxidants & redox signaling, 2010 - online.liebertpub.com
     
    3. Kinetic and thermodynamic aspects of cellular thioldisulfide redox regulation
    KS Jensen, RE Hansen - Antioxidants & Redox , 2009 - online.liebertpub.com
     
    4. Crystal structures of a poplar thioredoxin peroxidase that exhibits the structure of glutathione peroxidases: insights into redox-driven conformational changes
    CS Koh, C Didierjean, N Navrot, S Panjikar - Journal of molecular , 2007 - Elsevier
     
    5. The conserved active site proline determines the reducing power of Staphylococcus aureus thioredoxin
    G Roos, A Garcia-Pino, E Brosens, K Wahni - Journal of molecular , 2007 - Elsevier
     
    6. The zinc center influences the redox and thermodynamic properties of Escherichia coli thioredoxin 2
    HE Hajjaji, M Dumoulin, A Matagne, D Colau - Journal of molecular , 2009 - Elsevier
     
    7. Prediction of protein_glucose binding sites using support vector machines
    H Nassif, H Al_Ali, S Khuri - : Structure, Function, and , 2009 - Wiley Online Library
     
    8. Glutathione Peroxidase_Based Amperometric Biosensor for the Detection of S_Nitrosothiols
    M Musameh, N Moezzi, LM Schauman - , 2006 - Wiley Online Library
     
    9. Sulfolipid biosynthesis and function in plants
    C Benning, RM Garavito, M Shimojima - Sulfur metabolism in phototrophic , 2008 - Springer
     
    10. The INAD scaffold is a dynamic, redox-regulated modulator of signaling in the Drosophila eye
    W Liu, W Wen, Z Wei, J Yu, F Ye, CH Liu, RC Hardie - Cell, 2011 - Elsevier
     
    11. Sequence-structure and structure-function analysis in cysteine-rich domains forming the ultrastable nematocyst wall
    S Meier, PR Jensen, P Adamczyk, TW Holstein - Journal of molecular , 2007 - Elsevier
     
    12. Analysis of the structure and function of YfcG from Escherichia coli reveals an efficient and unique disulfide bond reductase
    MC Wadington, JE Ladner, NV Stourman, JM Harp - Biochemistry, 2009 - ACS Publications
     
    13. Reduction of the lipocalin type heme containing protein nitrophorin-Sensitivity of the fold-stabilizing cysteine disulfides toward routine heme-iron reduction
    M Knipp, JJ Taing, C He - Journal of inorganic biochemistry, 2011 - Elsevier
     
    14. An inductive logic programming approach to validate Hexose binding biochemical knowledge
    H Nassif, H Al-Ali, S Khuri, W Keirouz - Inductive Logic , 2010 - Springer
     
    15. Structural analysis of a glutathione transferase A1-1 mutant tailored for high catalytic efficiency with toxic alkenals
    LM Balogh, I Le Trong, KA Kripps, K Tars - Biochemistry, 2009 - ACS Publications
     
    16. Structural and Biochemical Characterization of Xylella fastidiosa DsbA Family Members: New Insights into the Enzyme_ Substrate Interaction
    FC Rinaldi, AN Meza, BG Guimara_es - Biochemistry, 2009 - ACS Publications
     
    17. Red blood cell glutathione peroxidase activity in female nulligravid and pregnant rats
    G Gallo, G Martino - Reproductive Biology and Endocrinology, 2009 - biomedcentral.com
     
    18. Theoretical Study on the Redox Cycle of Bovine Glutathione Peroxidase GPx1: p K a Calculations, Docking, and Molecular Dynamics Simulations
    ST Ali, S Jahangir, S Karamat - Journal of Chemical , 2010 - ACS Publications
     
    19. Structure and function of YghU, a nu-class glutathione transferase related to YfcG from Escherichia coli
    NV Stourman, MC Branch, MR Schaab, JM Harp - Biochemistry, 2011 - ACS Publications
     
    20. NMR Characterization of ProteinProtein and ProteinCofactor Interactions
    K Kubcek - 2006 - is.muni.cz
     
    21. Glutathione Peroxidase-4
    M Maiorino, V Bosello, G Cozza, A Roveri, S Toppo - Selenium, 2012 - Springer
     
    22. 3.3 THE GLUTATHIONE SYSTEM
    MF LOU - Redox biochemistry, 2008 - books.google.com
     
    23. 2.1 GLUTATHIONE
    JJ BARYCKI - Redox biochemistry, 2008 - books.google.com
     
    24. Selenoproteins of the Glutathione Peroxidase Family
    L Floh, R Brigelius-Floh - Selenium, 2012 - Springer
     
    25. Comprehensive Invited Review
    CH LILLIG, A HOLMGREN - ANTIOXIDANTS & REDOX SIGNALING, 2007 - lillig.de
     
    26. Delineation of the Pasteurellaceae-specific GbpA-family of glutathione-binding proteins
    B Vergauwen, R Van der Meeren - BMC , 2011 - biomedcentral.com
     
    27. 3.5. B GSH Transferases
    SD COPLEY - Redox biochemistry, 2008 - books.google.com
     
    28. Biological and Biochemical Aspects of Selenium Compounds
    BJ Bhuyan, G Mugesh - Organoselenium Chemistry, 2012 - Wiley Online Library
     
    29. Discovery of New Inhibitors of Cdc25B Dual Specificity Phosphatases by Structure-Based Virtual Screening
    A Lavecchia, C Di Giovanni, A Pesapane - Journal of Medicinal , 2012 - ACS Publications
     
    30. The bacterial SoxAX cytochromes
    U Kappler, MJ Maher - Cellular and Molecular Life Sciences, 2012 - Springer
     
    31. Valorisation of wild mushrooms as functional foods: chemoinformatic studies
    HJC Froufe - 2009 - bibliotecadigital.ipb.pt
     
    32. Structural biology of Schistosome: Glutathione Peroxidase and Thioredoxin Glutathione Reductase from a human parasite
    M Brunori, M Tripodi, D Dimastrogiovanni - 2011 - padis.uniroma1.it
     
    33. Investigation into Peroxiredoxin and interactions in the Peroxiredoxin peroxide scavenging system
    PBC James - 2010 - eric.exeter.ac.uk
     
    34. Stereochemical complexities in the glutathione S-transferase catalyzed detoxification of 4-hydroxynonenal
    LM Balogh - 2009 - books.google.com
     
    35. PARASITE PLASMODIUM FALCIPARUM
    STT Cu - 2009 - theses.flinders.edu.au
     
    36. The examination of hydrogen peroxide as a general signaling agent of dithiolethione cancer chemopreventives and its effects on human Keap1
    RJ Holland - 2009 - books.google.com
     
    37. STRUCTURE BASED MECHANISTIC STUDIES ON 2-KETOPROPYL COENZYME M OXIDOREDUCTASE/CARBOXYLASE FROM XANTHOBACTER
    AS Pandey - 2007 - etd.lib.montana.edu
     
    38. Targeted functional proteomics to study protein post-translational modification and protein-protein interactions
    Z Zhang - 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch