.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gu1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative lysostaphin peptidase from Vibrio cholerae. Proteins 72 1096-1103 2008
    Site NYSGXRC
    PDB Id 2gu1 Target Id NYSGXRC-6178d
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16
    Alias Ids TPS8255,9654929 Molecular Weight 47545.78 Da.
    Residues 426 Isoelectric Point 8.37
    Sequence mgqfrflalivavlcfsvalflptadepdqdsysvplnqsvntsqppssemvpsdirltplpqpkrihy mvkvgdtlsgifaqlgvpysilqkilsvdldhlqldmiqpgeelelmmddmgqlsrliyhmsivekaiy trendgsfsydfqeisgewreilfsgeingsfsvsarrvgltssqvanitqvmkdkidfsrslragdrf dilvkqqylgehntgnseikaisfklakgdvsaflaedgrfydragnslerafnrypvdkayrqitsgf npkrkhpvtgrvvphngtdfatpigapvystgdgkvivvrkhpyagnylviehnsvyktrylhldkilv kkgqlvkrgqkialagatgrltgphlhfevlvrnrpvdamkadlpiakslssnqktsflarvsefdhlv qanqqevaldet
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.264
    Matthews' coefficent 2.55 Rfactor 0.23
    Waters 133 Solvent Content 51.72

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1;ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2gu1
    1. A topological model of the baseplate of lactococcal phage Tuc2009
    G Sciara, S Blangy, M Siponen, S Mc Grath - Journal of Biological , 2008 - ASBMB
     
    2. Crystal structure of a putative lysostaphin peptidase from Vibrio cholerae
    S Ragumani, D Kumaran, SK Burley - Proteins: Structure, , 2008 - Wiley Online Library
     
    3. Crystal structure of the LasA virulence factor from Pseudomonas aeruginosa: substrate specificity and mechanism of M23 metallopeptidases
    J Spencer, LM Murphy, R Conners, RB Sessions - Journal of molecular , 2010 - Elsevier
     
    4. Crystal Structure of Outer Membrane Protein NMB0315 from Neisseria meningitidis
    X Wang, X Yang, C Yang, Z Wu, H Xu, Y Shen - PLoS One, 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch