.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gv8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mechanism of action of a flavin-containing monooxygenase. Proc.Natl.Acad.Sci.Usa 103 9832-9837 2006
    Site NYSGXRC
    PDB Id 2gv8 Target Id NYSGXRC-T1729
    Related PDB Ids 2gvc 1vqw 
    Molecular Characteristics
    Source Schizosaccharomyces pombe
    Alias Ids TPS8226,19112574 Molecular Weight 51095.85 Da.
    Residues 457 Isoelectric Point 6.81
    Sequence mslclptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvpstnpilt tepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqeyqriyaqpllpfiklat dvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpyipnikgldeyakavpgsvlhsslfr epelfvgesvlvvggassandlvrhltpvakhpiyqsllgggdiqneslqqvpeitkfdpttreiylkg gkvlsnidrviyctgylysvpfpslaklkspetkliddgshvhnvyqhifyipdptlafvglalhvvpf ptsqaqaaflarvwsgrlklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpv leeefpspywgekersirenmwsirakffgieppkeghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2592
    Matthews' coefficent 3.14 Rfactor 0.232
    Waters 432 Solvent Content 60.77

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2;NDP (NADPH) x 2;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2gv8
    1. Mechanism of action of a flavin-containing monooxygenase
    S Eswaramoorthy, JB Bonanno - Proceedings of the , 2006 - National Acad Sciences
     
    2. Revealing the moonlighting role of NADP in the structure of a flavin-containing monooxygenase
    A Alfieri, E Malito, R Orru - Proceedings of the , 2008 - National Acad Sciences
     
    3. Flavin-containing monooxygenases: mutations, disease and drug response
    IR Phillips, EA Shephard - Trends in pharmacological sciences, 2008 - Elsevier
     
    4. Functional characterization of genetic variants of human FMO3 associated with trimethylaminuria
    CK Yeung, ET Adman, AE Rettie - Archives of biochemistry and biophysics, 2007 - Elsevier
     
    5. Direct Electrochemistry of Drug Metabolizing Human Flavin-Containing Monooxygenase: Electrochemical Turnover of Benzydamine and Tamoxifen
    SJ Sadeghi, R Meirinhos, G Catucci - Journal of the , 2009 - ACS Publications
     
    6. Characterization of Sulfoxygenation and Structural Implications of Human Flavin-Containing Monooxygenase Isoform 2 (FMO2. 1) Variants S195L and N413K
    SK Krueger, MC Henderson, LK Siddens - Drug Metabolism and , 2009 - ASPET
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch