.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gvc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mechanism of action of a flavin-containing monooxygenase. Proc.Natl.Acad.Sci.Usa 103 9832-9837 2006
    Site NYSGXRC
    PDB Id 2gvc Target Id NYSGXRC-T1729
    Related PDB Ids 2gv8 1vqw 
    Molecular Characteristics
    Source Schizosaccharomyces pombe
    Alias Ids TPS8225,19112574 Molecular Weight 51095.85 Da.
    Residues 457 Isoelectric Point 6.81
    Sequence mslclptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvpstnpilt tepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqeyqriyaqpllpfiklat dvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpyipnikgldeyakavpgsvlhsslfr epelfvgesvlvvggassandlvrhltpvakhpiyqsllgggdiqneslqqvpeitkfdpttreiylkg gkvlsnidrviyctgylysvpfpslaklkspetkliddgshvhnvyqhifyipdptlafvglalhvvpf ptsqaqaaflarvwsgrlklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpv leeefpspywgekersirenmwsirakffgieppkeghhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.22 Rfree 0.2645
    Matthews' coefficent 3.15 Rfactor 0.23
    Waters 537 Solvent Content 60.97

    Ligand Information
    Ligands PEO (HYDROGEN) x 4;FAD (FLAVIN-ADENINE) x 4;MMZ (1-METHYL-1,3-DIHYDRO-2H-IMIDAZOLE-2-THIONE) x 4;GOL (GLYCEROL) x 4
    Metals

    Jmol

     
    Google Scholar output for 2gvc
    1. Mechanism of action of a flavin-containing monooxygenase
    S Eswaramoorthy, JB Bonanno - Proceedings of the , 2006 - National Acad Sciences
     
    2. Functional characterization of genetic variants of human FMO3 associated with trimethylaminuria
    CK Yeung, ET Adman, AE Rettie - Archives of biochemistry and biophysics, 2007 - Elsevier
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Characterization of Sulfoxygenation and Structural Implications of Human Flavin-Containing Monooxygenase Isoform 2 (FMO2. 1) Variants S195L and N413K
    SK Krueger, MC Henderson, LK Siddens - Drug Metabolism and , 2009 - ASPET
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch