.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hb6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Caenorhabditis Elegans Leucine Aminopeptidase. To be Published
    Site NYSGXRC
    PDB Id 2hb6 Target Id NYSGXRC-T2217
    Related PDB Ids 2hc9 
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS8282,17556903 Molecular Weight 52446.36 Da.
    Residues 491 Isoelectric Point 6.17
    Sequence mtqvlvrngiqavgdgltsliivgkksvlknvtfegkfkevaqkfvtdgdswnsmisripasgrhplhy elahlitvpdassrgntptnahsiykelkpinypedtknvhfvlfaeypdvlshvaaiartfckfsmkt sgirelnvnidvvcdkltnedavfltdlsesvretarlidtpanilttdalvdeavkvgnatgskitvi rgeellkagfggiyhvgkagptppafvvlshevpgstehialvgkgvvydtgglqiktktgmpnmkrdm ggaagmleaysalvkhgfsqtlhaclcivennvspiankpddiikmlsgktveinntdaegrliladgv fyaketlkattifdmatltgaqawlsgrlhgaamtndeqleneiikagkasgdlvapmlfapdlffgdl kssiadmknsnlgkmdgppsavaglfigahigfgeglrwlhldiaapaevgdrgtgygpalfstllgky tsvpmlkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.18279
    Matthews' coefficent 3.00 Rfactor 0.1474
    Waters 951 Solvent Content 58.80

    Ligand Information
    Ligands SO4 (SULFATE) x 6;GOL (GLYCEROL) x 12
    Metals NA (SODIUM) x 6

    Jmol

     
    Google Scholar output for 2hb6
    1. Assessment of predictions submitted for the CASP7 function prediction category
    G Lopez, A Rojas, M Tress - : Structure, Function, and , 2007 - Wiley Online Library
     
    2. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    4. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    5. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch