.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hc9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure and Function of Caenorhabditis Elegans Leucine Aminopeptidase. To be Published
    Site NYSGXRC
    PDB Id 2hc9 Target Id NYSGXRC-T2217
    Related PDB Ids 2hb6 
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS8283,17556903 Molecular Weight 52446.36 Da.
    Residues 491 Isoelectric Point 6.17
    Sequence mtqvlvrngiqavgdgltsliivgkksvlknvtfegkfkevaqkfvtdgdswnsmisripasgrhplhy elahlitvpdassrgntptnahsiykelkpinypedtknvhfvlfaeypdvlshvaaiartfckfsmkt sgirelnvnidvvcdkltnedavfltdlsesvretarlidtpanilttdalvdeavkvgnatgskitvi rgeellkagfggiyhvgkagptppafvvlshevpgstehialvgkgvvydtgglqiktktgmpnmkrdm ggaagmleaysalvkhgfsqtlhaclcivennvspiankpddiikmlsgktveinntdaegrliladgv fyaketlkattifdmatltgaqawlsgrlhgaamtndeqleneiikagkasgdlvapmlfapdlffgdl kssiadmknsnlgkmdgppsavaglfigahigfgeglrwlhldiaapaevgdrgtgygpalfstllgky tsvpmlkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.17526
    Matthews' coefficent 3.00 Rfactor 0.1417
    Waters 667 Solvent Content 58.97

    Ligand Information
    Ligands BCT (BICARBONATE) x 1;SO4 (SULFATE) x 2;GOL (GLYCEROL) x 16
    Metals ZN (ZINC) x 2;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2hc9
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Target selection for structural genomics based on combining fold recognition and crystallisation prediction methods: application to the human proteome
    JE Bray - Journal of Structural and Functional Genomics, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch