.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hcm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.STRUCT.FUNCT.GENOM. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2hcm Target Id NYSGXRC-8736b
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS7919,PF00782, NP_780327 Molecular Weight 17504.09 Da.
    Residues 163 Isoelectric Point 7.66
    Sequence mgtseaapppfarvapalfignaraagatellvragitlcvnvsrqqpgprapgvaelrvpvfddpaed llthleptcaameaavrdggsclvyckngrsrsaavctaylmrhrghsldrafqmvksarpvaepnlgf waqlqkyeqtlqaqailprepidpe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.19642
    Matthews' coefficent 2.03 Rfactor 0.15012
    Waters 169 Solvent Content 39.40

    Ligand Information
    Ligands WO4 (TUNGSTATE(VI)ION) x 1;GOL (GLYCEROL) x 1
    Metals ZN (ZINC) x 2;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2hcm
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    4. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    5. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary



    Ligand Summary

    tungstate-bound

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch