.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hf2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Domain Shifting Confirms Monomeric Structure of Escherichia Coli Sugar Phosphatase SupH. To be Published
    Site NYSGXRC
    PDB Id 2hf2 Target Id NYSGXRC-T791
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8133,1787043 Molecular Weight 31821.63 Da.
    Residues 283 Isoelectric Point 6.15
    Sequence mslsvkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasnnqyyqlisffpelkdeisfvae ngalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapeafvalmakhyhrlkpv kdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfgfidliipglhkangisrllkrwdl spqnvvaigdsgndaemlkmarysfamgnaaenikqiaryatddnnhegalnviqavldntspfnsegg shhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.25188
    Matthews' coefficent 2.21 Rfactor 0.20427
    Waters 398 Solvent Content 44.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hf2
    1. De-orphaning the structural proteome through reciprocal comparison of evolutionarily important structural features
    RM Ward, S Erdin, TA Tran, DM Kristensen - PloS one, 2008 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch