.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hj1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a 3D domain-swapped dimer of hypothetical protein from Haemophilus influenzae (CASP Target). To be Published
    Site NYSGXRC
    PDB Id 2hj1 Target Id NYSGXRC-2736c
    Molecular Characteristics
    Source Haemophilus influenzae rd
    Alias Ids TPS8193,16272344, 68057197 Molecular Weight 12936.99 Da.
    Residues 114 Isoelectric Point 7.03
    Sequence mslnqinieiayafperyylksfqvdegitvqtaitqsgilsqfpeidlstnkigifsrpikltdvlke gdrieiyrplladpkeirrkraaeqaaakdkekgaeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.231
    Matthews' coefficent 3.60 Rfactor 0.215
    Waters 75 Solvent Content 65.86

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2hj1
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    3. The crystal structure of the AF2331 protein from Archaeoglobus fulgidus DSM 4304 forms an unusual interdigitated dimer with a new type of _+ _ fold
    S Wang, O Kirillova, M Chruszcz, D Gront - Protein , 2009 - Wiley Online Library
     
    4. Protein Structure Prediction Using Coarse Grain Force Fields
    N Mahmood, A Torda - 2010 - nasirmaan.com
     
    5. Dke1structure, dynamics, and function: a theoretical and experimental study elucidating the role of the binding site shape and the hydrogen-bonding network in
    H Brki_, D Buongiorno, M Ramek, G Straganz - Journal of Biological , 2012 - Springer
     
    6. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    7. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     
    8. New protein structure prediction method using inter-residue distances and a theoretical investigation of the isomerization of azobenzene and disubstituted
    CR Crecca - 2008 - ufdcimages.uflib.ufl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch