.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hne

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. ATCC 33913. To be Published
    Site NYSGXRC
    PDB Id 2hne Target Id NYSGXRC-9435a
    Molecular Characteristics
    Source Xanthomonas campestris
    Alias Ids TPS7837,NP_639408, PF01188 Molecular Weight 48121.08 Da.
    Residues 441 Isoelectric Point 5.21
    Sequence mrtiialethdvrfptsreldgsdamnpdpdysaayvvlrtdgaedlagyglvftigrgndvqtaavaa laehvvglsvdkviadlgafarrltndsqlrwlgpekgvmhmaigavinaawdlaaraankplwrfiae ltpeqlvdtidfrylsdaltrdealailrdaqpqraartatlieqgypayttspgwlgysdeklvrlak eavadgfrtiklkvganvqddirrcrlaraaigpdiamavdanqrwdvgpaidwmrqlaefdiawieep tspddvlghaairqgitpvpvstgehtqnrvvfkqllqagavdliqidaarvggvnenlailllaakfg vrvfphaggvglcelvqhlamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaem hpasiaefsypdgrfwvedlaaskaka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.274
    Matthews' coefficent 2.53 Rfactor 0.241
    Waters 295 Solvent Content 51.33

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch