.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hsi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of M23 Peptidase from Pseudomonas Aeruginosa. To be Published
    Site NYSGXRC
    PDB Id 2hsi Target Id NYSGXRC-6451a
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS7762,NP_252476.1, PF01551 Molecular Weight 30771.97 Da.
    Residues 282 Isoelectric Point 9.87
    Sequence mprtlafvstlllaafcalpaqadsfimrllnkpvpggvavvdlgeegppprafyqgkpvlvvreegrr wiavvgiplstkpgpqklevraatgnheerfsvgskhyreqritlknkrqvnplpedlkrierelaeqt aayrrfspglpsnlmldkpvdgplsspfglrrffngeernphsgldfavpagtpikapaagkviligdy ffngktvfvdhgqgfismfchlskidvklgqqvprggvlgkvgatgratgphmhwnvslndarvdpaif igafqp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.24522
    Matthews' coefficent 2.30 Rfactor 0.20419
    Waters 485 Solvent Content 45.80

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2hsi
    1. Crystal structure of a putative lysostaphin peptidase from Vibrio cholerae
    S Ragumani, D Kumaran, SK Burley - Proteins: Structure, , 2008 - Wiley Online Library
     
    2. Crystal structure of the LasA virulence factor from Pseudomonas aeruginosa: substrate specificity and mechanism of M23 metallopeptidases
    J Spencer, LM Murphy, R Conners, RB Sessions - Journal of molecular , 2010 - Elsevier
     
    3. Structure modeling of a metalloendopeptidase from Corynebacterium pseudotuberculosis
    LC Guimares, NF Silva, A Miyoshi - Computers in Biology , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch