.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hxg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Mn2+-bound Escherichia coli L-arabinose Isomerase (ECAI) and Implications in Protein Catalytic Mechanism and Thermo-Stability. The Journal of Young Investigators 17 2007
    Site NYSGXRC
    PDB Id 2hxg Target Id NYSGXRC-6358a
    Related PDB Ids 2ajt 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS7760,PF02610, NP_414604.1 Molecular Weight 56041.10 Da.
    Residues 500 Isoelectric Point 5.88
    Sequence mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdeitaicrdany ddpcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdfmnlnqtahggrefgfiga rmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcrfgdnmrevavtdgdkvaaqikfgfsvn twavgdlvqvvnsisdgdvnalvdeyescytmtpatqihgekrqnvleaarielgmkrfleqggfhaft ttfedlhglkqlpglavqrlmqqgygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndl vlgshmlevcpsiaveekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvk tphslpklpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndtrlp afkdalrwnevyygfrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.80 Rfree 0.28811
    Matthews' coefficent 2.52 Rfactor 0.22878
    Waters 103 Solvent Content 51.15

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 3

    Jmol

     
    Google Scholar output for 2hxg
    1. Crystal structure of Mn2+-bound Escherichia coli L-arabinose isomerase (ECAI) and implications in protein catalytic mechanism and thermo-stability
    W Zhu, B Manjasetty, M Chance - Journal of Young Investigators, 2007 - osti.gov
     
    2. The impact of Structural Proteomics on Biotechnology
    BA Manjasetty, AP Turnbull - and Genetic Engineering , 2010 - ingentaconnect.com
     
    3. Identification of two-histidines one-carboxylate binding motifs in proteins amenable to facial coordination to metals
    B Amrein, M Schmid, G Collet, P Cuniasse, F Gilardoni - Metallomics, 2012 - xlink.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch