.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hxp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.Struct.Funct.Genom. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2hxp Target Id NYSGXRC-8638a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7910,PF00782, NP_001386 Molecular Weight 41865.14 Da.
    Residues 384 Isoelectric Point 5.80
    Sequence meglgrsclwlrrelspprprlllldcrsrelyesariggalsvalpalllrrlrrgslsvrallpgpp lqppppapvllydqgggrrrrgeaeaeaeeweaesvlgtllqklreegylayylqggfsrfqaecphlc etslagragssmapvpgpvpvvglgslclgsdcsdaeseadrdsmscgldsegatpppvglrasfpvqi lpnlylgsardsanleslaklgiryilnvtpnlpnffekngdfhykqipisdhwsqnlsrffpeaiefi dealsqncgvlvhclagvsrsvtvtvaylmqklhlslndaydlvkrkksnispnfnfmgqlldferslr leerhsqeqgsggqasaasnppsffttptsdgafelapt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.83 Rfree 0.246
    Matthews' coefficent 2.49 Rfactor 0.216
    Waters 100 Solvent Content 50.68

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2hxp
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Overproduction, purification and structure determination of human dual-specificity phosphatase 14
    GT Lountos, JE Tropea, S Cherry - Section D: Biological , 2009 - scripts.iucr.org
     
    3. ProDy Documentation
    A Bakan - 2012 - csb.pitt.edu
     
    4. PRIME 2011 Osaka University September 1 2011 Mentors: Dr. Haga and Dr. Date
    B Tsui - 2011 - prime.ucsd.edu
     

    Protein Summary



    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch