.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hzg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of predicted Mandelate racemase from Rhodobacter sphaeroides. To be Published
    Site NYSGXRC
    PDB Id 2hzg Target Id NYSGXRC-9278a
    Molecular Characteristics
    Source Rhodobacter sphaeroides
    Alias Ids TPS7803,PF01188, 22960130 Molecular Weight 41245.54 Da.
    Residues 391 Isoelectric Point 5.28
    Sequence mkidavdlfylsmpevtdaadgsqdallvrvaagghigwgeceaaplpsiaafvcpkshgvcrpvsdsv lgqrldgpddiariaalvgynsmdllqaphmlsgiemalwdllgrrlsapawallgysashgkrpyasl lfgdtpqetleraraarrdgfaavkfgwgpigrgtvaadadqimaareglgpdgdlmvdvgqifgedve aaaarlptldaagvlwleepfdagalaahaalagrgarvriaggeaahnfhmaqhlmdygrigfiqidc grigglgpakrvadaaqargityvnhtftshlalsaslqpfagleadriceypaapqqlalditgdhir pdaeglirapeapglglqvaasalrrylveteiriggqliyrtpql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.02 Rfree 0.19453
    Matthews' coefficent 2.85 Rfactor 0.14983
    Waters 895 Solvent Content 56.92

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals NA (SODIUM) x 3

    Jmol

     
    Google Scholar output for 2hzg
    1. Protein secondary structure predict based on the path with the maximum weight
    L Luo, Z Shao - Computing and Intelligent Systems, 2009. ICIS , 2009 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch