.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i0o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.STRUCT.FUNCT.GENOM. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2i0o Target Id NYSGXRC-8886z
    Molecular Characteristics
    Source Anopheles gambiae
    Alias Ids TPS7926,XP_316230, PF00481 Molecular Weight 33024.36 Da.
    Residues 302 Isoelectric Point 4.79
    Sequence gaylseplttkdssdesneflasgsssmqgwrisqedahncilnfddqcsffavydghggaevaqycsl hlptflktveaygrkefekalkeaflgfdatllqekvieelkvlsgdsagsdaepgkdsgctavvallh gkdlyvanagdsrcvvcrngkalemsfdhkpedtveyqriekaggrvtldgrvngglnlsraigdhgyk mnkslpaeeqmisalpdiekitvgpedefmvlacdgiwnfmtseqvvqfvqerinkpgmklskiceelf dhclaphtrgdgtgcdnmtaiivqfk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.23475
    Matthews' coefficent 2.21 Rfactor 0.18166
    Waters 385 Solvent Content 44.25

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 6

    Jmol

     
    Google Scholar output for 2i0o
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Optimization of a cyclic peptide inhibitor of Ser/Thr phosphatase PPM1D (Wip1)
    R Hayashi, K Tanoue, SR Durell, DK Chatterjee - Biochemistry, 2011 - ACS Publications
     

    Protein Summary



    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch