.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i3o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of gamma-glutamyl transferase related protein from Thermoplasma acidophilum. To be Published
    Site NYSGXRC
    PDB Id 2i3o Target Id NYSGXRC-6324d
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS7758,NP_394454.1, PF01019 Molecular Weight 56721.82 Da.
    Residues 516 Isoelectric Point 4.99
    Sequence mfrsrpnalsqrsviassselaslagrdilkrggnifdaalavsamlcvtqnnlcglggdlfalirden gqimdlngsgqasravsidyyesmgltkipergpyaaitvpgiagswdeifrkfatmdiadilepairt asagfpitqnysdsiarsapvigqyrgwssifmpngsvpvageilkqpdlaesfrlmseegfrsfydgs ladiiiaglegtgsplsdrdlrvyrpligkpvftdldefriyetspnsqgitviewirgmeshgydsrt mweakiedifetmeeaydkrrkitdpsymniaqhdsangkkdglpkrdhndigdttyfsisdsegrsvs iiqsnymgfgsgivpkgtgfvlqnrgsyftlqrdhpnalmpgkrtfhtlaacmvekehdlyaslgsmgg diqpqvqmqilmeilkdntdpqaildkprwtepytiyeapgavyveseelyrnvskqisgrkvvlrdvs qefgtaqittlirgdvvvgaadprgdgiaipys
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.03 Rfree 0.207
    Matthews' coefficent 2.69 Rfactor 0.183
    Waters 887 Solvent Content 54.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i3o
    1. Crystal structure of Bacillus anthracis transpeptidase enzyme CapD
    R Wu, S Richter, R Zhang, VJ Anderson - Journal of Biological , 2009 - ASBMB
     
    2. Gene cloning and protein expression of _-glutamyltranspeptidases from Thermus thermophilus and Deinococcus radiodurans: comparison of molecular and structural
    I Castellano, A Di Salle, A Merlino, M Rossi, F La Cara - Extremophiles, 2011 - Springer
     
    3. _-Glutamyltranspeptidases: sequence, structure, biochemical properties, and biotechnological applications
    I Castellano, A Merlino - Cellular and Molecular Life Sciences, 2012 - Springer
     
    4. Bioinformatic and experimental fishing for artemisinin-interacting proteins from human nasopharyngeal cancer cells
    T Eichhorn, S Schloissnig, B Hahn, A Wendler - Mol. BioSyst., 2012 - xlink.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch