.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i44

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.Struct.Funct.Genom. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2i44 Target Id NYSGXRC-8817z
    Molecular Characteristics
    Source Toxoplasma gondii
    Alias Ids TPS7923,CAC86553.2, PF00481 Molecular Weight 35729.67 Da.
    Residues 322 Isoelectric Point 5.23
    Sequence tmdvpptihvplpptsypafdaaiftdiggrkhqedrftlcpqlvpgrddcaffgvfdgtvgdfasenv kdlvvpqlisspawqevtemlrsdvpatevdeklpqlldqavddmyknadnelvkmceqlnkdyassts vtavlakgfvavghlgdsriamgvetpnglncefltvdhkpdmpheklrimrnggsveylhnhnnkpfi rggdfsfrksrgeqpmqlqysrafggkdlkmyglsnqpdvrvvrvtpqhrvmilatdglwdvmsaaqav eiamqarqegrnpaqalvemtlaeqqsrnqsadnitamtvffkktd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.04 Rfree 0.2445
    Matthews' coefficent 2.60 Rfactor 0.2188
    Waters 353 Solvent Content 52.67

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 6

    Jmol

     
    Google Scholar output for 2i44
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Structure of Streptococcus agalactiae serine/threonine phosphatase
    MK Rantanen, L Lehti, L Rajagopal, CE Rubens - Febs , 2007 - Wiley Online Library
     
    3. Crystal structure of pyruvate dehydrogenase phosphatase 1 and its functional implications
    DG Vassylyev, J Symersky - Journal of molecular biology, 2007 - Elsevier
     
    4. The Bacterial Stressosome: A Modular System that Has Been Adapted to Control Secondary Messenger Signaling
    MB Quin, JM Berrisford, JA Newman, A Basl - Structure, 2012 - Elsevier
     
    5. Optimization of a cyclic peptide inhibitor of Ser/Thr phosphatase PPM1D (Wip1)
    R Hayashi, K Tanoue, SR Durell, DK Chatterjee - Biochemistry, 2011 - ACS Publications
     

    Protein Summary

    uncharacterized PP2C phosphatase from Toxoplasma gondii.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch