.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i5g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of amidohydrolase from Pseudomonas aeruginosa. To be Published
    Site NYSGXRC
    PDB Id 2i5g Target Id NYSGXRC-9311a
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS7818,PF01244, 15600589 Molecular Weight 36078.23 Da.
    Residues 325 Isoelectric Point 5.47
    Sequence mspaelhadsividgliiakwnrelfedmrkggltaanctvsvwegfqatvnniaasnklirdnsdlvi pvrstadirkakeqgktgilygfqnahafedqigyvevfkqlgvgivqmcyntqnlvgtgcyerdggls gfgreivaemnrvgimcdlshvgsktseevileskkpvcyshclpsglkehprnksdeelkfiadhggf vgvtmfapflkkgidstiddyaeaieyvmnivgedaigigtdftqghghdffewlthdkgyarrltnfg kivnplgirtvgefpnltetllergmpervvrkvmgenwvrvlrdvwge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.25
    Matthews' coefficent 2.87 Rfactor 0.181
    Waters 544 Solvent Content 57.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i5g
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch