.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i5h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein AF1531 from Archaeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 2i5h Target Id NYSGXRC-10225b
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8004,O28741, PF04919 Molecular Weight 23192.95 Da.
    Residues 195 Isoelectric Point 9.55
    Sequence mekpkversegkekledyayvldfmpyghpddkrpihrreplaqvvgernftllevsirkgkqplvmdr vyigkgerdvvykikrrlryedltpaaktelpyviehiikqdekkyvdffnkadsittrmhqlellpgv gkkmmwaiieerkkrpfesfediaqrvkgiqrpeklivsriiyeiknpqtkyklfta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.74 Rfree 0.2581
    Matthews' coefficent 2.49 Rfactor 0.2279
    Waters 132 Solvent Content 50.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i5h
    1. RNomics and Modomics in the halophilic archaea Haloferax volcanii: identification of RNA modification genes
    H Grosjean, C Gaspin, C Marck, WA Decatur - BMC , 2008 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch