.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i5q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Evolution of enzymatic activities in the enolase superfamily: L-rhamnonate dehydratase. Biochemistry 47 9944-9954 2008
    Site NYSGXRC
    PDB Id 2i5q Target Id NYSGXRC-9265b
    Molecular Characteristics
    Source Escherichia coli o157:h7
    Alias Ids TPS7796,15802796, PF01188 Molecular Weight 44734.84 Da.
    Residues 405 Isoelectric Point 5.75
    Sequence menimtlpkikqvrawftggataekgagggdyhdqganhwiddhiatpmskyrdyeqlrqsfginvlgt lvveveaengqtgfavstagemgcfivekhlnrfiegkcvsdiklihdqmlnatlyysgsgglvmntis cvdlalwdlfgkvvglpvykllggavrdeiqfyatgarpdlakemgfiggkmpthwgphdgdagirkda amvadmrekcgedfwlmldcwmsqdvnyatklahacapynlkwieeclppqqyegyrelkrnapvgmmv tsgehhgtlqsfrtlsetgidimqpdvgwcgglttlveiaaiaksrgqlvvphgssvyshhavitftnt pfseflmtspdcstmrpqfdpillnepvpvngrihksvldkpgfgvelnrdcnlkrpysh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.259
    Matthews' coefficent 2.20 Rfactor 0.229
    Waters 110 Solvent Content 43.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i5q
    1. Evolution of Enzymatic Activities in the Enolase Superfamily: l-Rhamnonate Dehydratase
    JF Rakus, AA Fedorov, EV Fedorov, ME Glasner - Biochemistry, 2008 - ACS Publications
     
    2. Evolution of Enzymatic Activities in the Enolase Superfamily: d-Mannonate Dehydratase from Novosphingobium aromaticivoran s
    JF Rakus, AA Fedorov, EV Fedorov, ME Glasner - Biochemistry, 2007 - ACS Publications
     
    3. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    4. Crystal Structure and Functional Assignment of YfaU, a Metal Ion Dependent Class II Aldolase from Escherichia coli K12
    D Rea, R Hovington, JF Rakus, JA Gerlt, V Fu_lo_p - Biochemistry, 2008 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch