.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i76

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein TM1727 from Thermatoga maritima. TO BE PUBLISHED
    Site NYSGXRC
    PDB Id 2i76 Target Id NYSGXRC-T1650
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8213,15644473 Molecular Weight 31235.28 Da.
    Residues 276 Isoelectric Point 6.65
    Sequence mslvlnfvgtgtltrffleclkdryeigyilsrsidrarnlaevyggkaatlekhpelngvvfvivpdr yiktvanhlnlgdavlvhcsgflsseifkksgrasihpnfsfsslekalemkdqivfglegderglpiv kkiaeeisgkyfvipsekkkayhlaaviasnfpvalaylskriytllgldepellihtlmkgvadnikk mrvecsltgpvkrgdwqvveeerreyekifgntvlydeivkllrevaeserreaqedereggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.288
    Matthews' coefficent 2.53 Rfactor 0.236
    Waters 44 Solvent Content 51.42

    Ligand Information
    Ligands NDP (NADPH) x 2
    Metals

    Jmol

     
    Google Scholar output for 2i76
    1. Aromatic-Aromatic Interactions Database, A2ID: An Analysis of Aromatic [pi]-Networks in Proteins
    M Chourasia, GM Sastry, GN Sastry - International Journal of Biological , 2011 - Elsevier
     
    2. Hidden Relationship between Conserved Residues and Locally Conserved Phosphate-Binding Structures in NAD (P)-Binding Proteins
    CY Wu, YH Hwa, YC Chen, C Lim - The Journal of Physical , 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch