.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i9i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Helicobacter pylori hypothetical protein O25234. TO BE PUBLISHED
    Site NYSGXRC
    PDB Id 2i9i Target Id NYSGXRC-10226b
    Molecular Characteristics
    Source Helicobacter pylori
    Alias Ids TPS8006,PF05211, O25234 Molecular Weight 31946.08 Da.
    Residues 278 Isoelectric Point 9.13
    Sequence merslifkkvriyskmlvalglssvligcamnpsaetktpndaknqvqthermktssehvtpldfnypi hivqapqnhhvvgiltpriqvsdnlkpyidkfqdalinqiqtifekrgyqvlrfqdekalnaqdkrkif svldlkgwvgiledlkmnlkdpnnpnldtlvdqssgsvwfnfyepesnrvvhdfavevgtfqamtytyk hnnsgglnssnsiiheyleknkedaihkilnrmyavvmkkavteltkenidkyreaidrmkgfkssmpqkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.24926
    Matthews' coefficent 2.32 Rfactor 0.20364
    Waters 156 Solvent Content 47.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i9i
    1. Structural motif screening reveals a novel, conserved carbohydrate-binding surface in the pathogenesis-related protein PR-5d
    AC Doxey, Z Cheng, BA Moffatt - BMC structural , 2010 - biomedcentral.com
     
    2. Structural Analysis of Hypothetical Proteins from Helicobacter pylori: An Approach to Estimate Functions of Unknown or Hypothetical Proteins
    SJ Park, WS Son, BJ Lee - International Journal of Molecular Sciences, 2012 - mdpi.com
     
    3. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch