.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i9u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Guanine Deaminase from C. acetobutylicum with bound guanine in the active site. To be Published
    Site NYSGXRC
    PDB Id 2i9u Target Id NYSGXRC-9246a
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS7778,15023121, PF01979 Molecular Weight 48530.30 Da.
    Residues 428 Isoelectric Point 8.46
    Sequence lekdinlkifkgnliftktsdkftimkdsyivvidgkiasvssnlpdkykgnpiidfrnniiipgmndl hahasqyknlgigmdkellpwlnnytfpeeakflnvdyakktygrlikdlikngttrvalfatlhkdst ielfnmliksgigayvgkvnmdyncpdyltenyitslndteeiilkykdksnivkpiitprfvpscsne lmdglgklsykyrlpvqshlsenldeiavvkslhkksnfygevydkfglfgntptlmahcihsskeein likrnnvtivhcptsnfnlgsgmmpvrkylnlginvvlgsdisaghtcslfkviayaiqnskikwqesg kkdmflstseafymatkkggsffgkvgsfeegydfdalvindsnlypedydlterlerfiylgddrnim kryvcgneifgpkf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.224
    Matthews' coefficent 2.72 Rfactor 0.194
    Waters 420 Solvent Content 54.72

    Ligand Information
    Ligands GUN (GUANINE) x 2;GOL (GLYCEROL) x 1
    Metals FE (FE) x 2

    Jmol

     
    Google Scholar output for 2i9u
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. Structural characterization of the zinc binding domain in cytosolic PSD_95 interactor (cypin): Role of zinc binding in guanine deamination and dendrite branching
    JR Fernndez, WJ Welsh - : Structure, Function, and , 2008 - Wiley Online Library
     
    3. Phylogenetic analysis and molecular evolution of guanine deaminases: from guanine to dendrites
    JR Fernndez, B Byrne, BL Firestein - Journal of molecular evolution, 2009 - Springer
     
    4. Bacterial ammeline metabolism via guanine deaminase
    JL Seffernick, AG Dodge, MJ Sadowsky - Journal of , 2010 - Am Soc Microbiol
     
    5. Structural characterization and transcriptional regulation of the cytosolic PSD-95 interacting protein (CYPIN) and its role in neuronal dendrite branching
    JR Fernandez - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch