.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ia1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of hypothetical protein BH3703 from Bacillus halodurans. To be Published
    Site NYSGXRC
    PDB Id 2ia1 Target Id NYSGXRC-10195b
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS7994,Q9K6M5, PF04634 Molecular Weight 20663.01 Da.
    Residues 169 Isoelectric Point 4.43
    Sequence mekqiesyyqeiaqliidmipeewaevrfyaqedhdgwkifffhylsassdewtkdidirdvikvpqde fmekynelsfcisdfrkdyaeafgepwmsfqmtfyasgkfnidfyydknpfdtfltrlawqyehfgtip edsfyketlneyleekaqgkrypfleplkee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.59 Rfree 0.192
    Matthews' coefficent 3.04 Rfactor 0.172
    Waters 439 Solvent Content 59.56

    Ligand Information
    Ligands SO4 (SULFATE) x 1;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2ia1
    1. Gauge field theory of chirally folded homopolymers with applications to folded proteins
    UH Danielsson, M Lundgren, AJ Niemi - Physical Review E, 2010 - APS
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch